PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625714.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 286aa    MW: 33097.1 Da    PI: 7.5685
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625714.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.6e-143481148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l + +  +G  +W+t++ + g+ R +k+c++rw +yl
   XP_013625714.1 34 KGFWSPEEDEKLRRFILSHGHSCWTTVPIKAGLQRNGKSCRLRWINYL 81
                     688*******************************************97 PP

2Myb_DNA-binding48.12.7e-1591132548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++eE+e+++  +  lG++ W++Ia++++ gRt++++k++w+++l
   XP_013625714.1  91 SAEEEEIILTFHSSLGNK-WSKIAQYLP-GRTDNEIKNYWHSHL 132
                      89****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2422981IPR017930Myb domain
SuperFamilySSF466892.16E-2731128IPR009057Homeodomain-like
SMARTSM007173.8E-103383IPR001005SANT/Myb domain
PfamPF002498.9E-123581IPR001005SANT/Myb domain
CDDcd001675.55E-83781No hitNo description
Gene3DG3DSA:1.10.10.605.5E-203788IPR009057Homeodomain-like
PROSITE profilePS5129422.23682136IPR017930Myb domain
SMARTSM007172.7E-1386134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2389135IPR009057Homeodomain-like
CDDcd001675.06E-1091132No hitNo description
PfamPF002491.5E-1391132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MYICSLNHNI HTCFRTEIMA KTKSGEMLKE RQRKGFWSPE EDEKLRRFIL SHGHSCWTTV  60
PIKAGLQRNG KSCRLRWINY LRPGLKRDMI SAEEEEIILT FHSSLGNKWS KIAQYLPGRT  120
DNEIKNYWHS HLKKRWLKPP SMSSSSESRV SCRERNPQTL VSNHVISFQG LPDKTSSSPS  180
EESNNNYLCS SGPEIPRLFF SEWFSSSDLT DSNHNHAPSI EGTISDYQES GDVDRFHYNN  240
MMMNNSNWTL EDIVFGSKCQ KQEHNVDREG LDCNSSDILF SSSIMM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-23341357107B-MYB
1h89_C3e-221513539158MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-221513539158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196091e-128AY519609.1 Arabidopsis thaliana MYB transcription factor (At4g25560) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625714.10.0PREDICTED: transcription factor LAF1-like
RefseqXP_013646753.10.0PREDICTED: transcription factor LAF1-like
RefseqXP_013646754.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K41e-140LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0D3A6C20.0A0A0D3A6C2_BRAOL; Uncharacterized protein
STRINGAT4G25560.11e-137(Arabidopsis thaliana)
STRINGBra019154.1-P1e-135(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-130myb domain protein 18